ALKBH1 Antikörper

Produktnummer ABIN7879953

Der Kaninchen Polyklonal anti-ALKBH1 Antikörper wird verwendet zum Nachweis von ALKBH1 in Proben von Human. Er wurde validiert für WB und IF.

Kurzübersicht für ALKBH1 Antikörper (ABIN7879953)

Target: ALKBH1 (AlkB, Alkylation Repair Homolog 1 (ALKBH1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALKBH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF)

Produktdetails anti-ALKBH1 Antikörper

Verwendungszweck: ALKBH1 Antibody

Sequenz: YLKTARVNMT VRQVLATDQN FPLEPIEDEK RD

Aufreinigung: Affinity purified

Immunogen: Amino acids YLKTARVNMTVRQVLATDQNFPLEPIEDEKRD from the human protein were used as the immunogen for the ALKBH1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ALKBH1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ALKBH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ALKBH1

Target: ALKBH1 (AlkB, Alkylation Repair Homolog 1 (ALKBH1))

Andere Bezeichnung: ALKBH1

Hintergrund: Nucleic acid dioxygenase ALKBH1 is an enzyme that in humans is encoded by the ALKBH1 gene. It is mapped to 14q24.3. This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

UniProt: Q13686

Pathways: DNA Reparatur