AFF4 Antikörper

Produktnummer ABIN7879910

Dieser Maus Monoklonal Antikörper detektiert spezifisch AFF4 in WB und FACS. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für AFF4 Antikörper (ABIN7879910)

Target: AFF4 (AF4/FMR2 Family, Member 4 (AFF4))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser AFF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS)

Klon: 8G12

Produktdetails anti-AFF4 Antikörper

Verwendungszweck: AFF4 Antibody

Sequenz: RNVLRMKERE RRNQEIQQGE DAFPPSSPLF AEPYKVTSKE DKLSSRIQ

Aufreinigung: Affinity purified

Immunogen: Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AFF4 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu AFF4

Target: AFF4 (AF4/FMR2 Family, Member 4 (AFF4))

Andere Bezeichnung: AFF4

Hintergrund: The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.

UniProt: Q9UHB7