14-3-3 zeta Antikörper

Produktnummer ABIN7879845

Der Maus Monoklonal anti-14-3-3 zeta Antikörper wird verwendet zum Nachweis von 14-3-3 zeta in Proben von Human, Maus, Ratte und Affe. Er wurde validiert für WB und FACS.

Kurzübersicht für 14-3-3 zeta Antikörper (ABIN7879845)

Target: 14-3-3 zeta (YWHAZ)

Reaktivität: Human, Maus, Ratte, Affe

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser 14-3-3 zeta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS)

Klon: 6G5

Produktdetails anti-14-3-3 zeta Antikörper

Verwendungszweck: YWHAZ Antibody / 14-3-3 zeta/delta

Sequenz: LLEKFLIPNA SQAESKVFYL KMKGDYYRYL AEVAAGDDKK GIVDQ

Aufreinigung: Affinity purified

Immunogen: Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ from the human protein were used as the immunogen for the YWHAZ antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the YWHAZ antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the YWHAZ antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu 14-3-3 zeta

Target: 14-3-3 zeta (YWHAZ)

Andere Bezeichnung: YWHAZ

Hintergrund: 14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

UniProt: P63104

Pathways: Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location