DHODH Antikörper (N-Term)

Produktnummer ABIN7879598

Dieser Maus Monoklonal Antikörper detektiert spezifisch DHODH in WB, IF und FACS. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für DHODH Antikörper (N-Term) (ABIN7879598)

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser DHODH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Klon: 4E3-

Produktdetails anti-DHODH Antikörper

Bindungsspezifität: N-Term

Verwendungszweck: DHODH Antibody / Dihydroorotate dehydrogenase

Sequenz: RVFRLPEDQA VINRYGFNSH GLSVVEHRLR ARQQKQAKLT ED

Aufreinigung: Antigen affinity purified

Immunogen: N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED from the human protein were used as the immunogen for the DHODH antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the DHODH antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the DHODH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu DHODH

Target: DHODH (Dihydroorotate Dehydrogenase (DHODH))

Andere Bezeichnung: DHODH

Hintergrund: Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

UniProt: Q02127

Pathways: Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus