SOD2 Antikörper (C-Term)

Produktnummer ABIN7877480

Dieser Maus Monoklonal Antikörper detektiert spezifisch SOD2 in WB und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für SOD2 Antikörper (C-Term) (ABIN7877480)

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Reaktivität: Human, Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser SOD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 2B12B1

Produktdetails anti-SOD2 Antikörper

Bindungsspezifität: C-Term

Verwendungszweck: Superoxide Dismutase 2 Antibody / SOD2

Sequenz: QYKNVRPDYL KAIWNVINWE NVTERYMACK K

Aufreinigung: Antigen affinity purified

Immunogen: C-terminal amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK were used as the immunogen for the Superoxide Dismutase 2 antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Superoxide Dismutase 2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Superoxide Dismutase 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu SOD2

Target: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Andere Bezeichnung: Superoxide Dismutase 2

Hintergrund: SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.

UniProt: P04179

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling