RAB11A Antikörper (C-Term)

Produktnummer ABIN7877466

Der Maus Monoklonal anti-RAB11A Antikörper wird verwendet zum Nachweis von RAB11A in Proben von Human, Maus und Ratte. Er wurde validiert für WB, IF, IHC (p) und FACS.

Kurzübersicht für RAB11A Antikörper (C-Term) (ABIN7877466)

Target: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser RAB11A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Klon: 4H9

Produktdetails anti-RAB11A Antikörper

Bindungsspezifität: C-Term

Verwendungszweck: RAB11A Antibody

Sequenz: EIYRIVSQKQ MSDRRENDMS PSNNVVPIHV PPTTENKPKV Q

Aufreinigung: Antigen affinity purified

Immunogen: C-terminal region amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ from the human protein were used as the immunogen for the RAB11A antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the RAB11A antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the RAB11A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu RAB11A

Target: RAB11A (RAB11A, Member RAS Oncogene Family (RAB11A))

Andere Bezeichnung: RAB11A

Hintergrund: Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.

UniProt: P62491

Pathways: Regulation of Cell Size, Thromboxane A2 Receptor Signaling, Regulation of long-term Neuronal Synaptic Plasticity