RAGE Antikörper (AA 91-120)

Produktnummer ABIN7877133

Der Maus Monoklonal anti-RAGE Antikörper wird verwendet zum Nachweis von RAGE in Proben von Human, Maus und Ratte. Er wurde validiert für WB, FACS und IHC (p).

Kurzübersicht für RAGE Antikörper (AA 91-120) (ABIN7877133)

Target: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Reaktivität: Human, Maus, Ratte

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser RAGE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 5C6C1

Produktdetails anti-RAGE Antikörper

Bindungsspezifität: AA 91-120

Verwendungszweck: AGER Antibody / RAGE

Sequenz: IQDEGIFRCQ AMNRNGKETK SNYRVRVYQI

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 91-120 (IQDEGIFRCQAMNRNGKETKSNYRVRVYQI) from the human protein were used as the immunogen for the AGER antibody.

Isotyp: IgG2b

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AGER antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the AGER antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu RAGE

Target: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Andere Bezeichnung: AGER

Hintergrund: The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

UniProt: Q15109

Pathways: Carbohydrate Homeostasis, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, S100 Proteine