ACO2 Antikörper (AA 561-596)

Produktnummer ABIN7875784

Der Maus Monoklonal anti-ACO2 Antikörper (Klon 4C12D1) (ABIN7875784) detektiert spezifisch ACO2 in WB und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für ACO2 Antikörper (AA 561-596) (ABIN7875784)

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Reaktivität: Human, Ratte, Maus

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser ACO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Klon: 4C12D1

Produktdetails anti-ACO2 Antikörper

Bindungsspezifität: AA 561-596

Verwendungszweck: ACO2 Antibody / Aconitase 2

Sequenz: TSQRLQLLEP FDKWDGKDLE DLQILIKVKG KCTTDH

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 561-596 (TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH) were used as the immunogen for the ACO2 antibody.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ACO2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ACO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ACO2

Target: ACO2 (Aconitase 2, Mitochondrial (ACO2))

Andere Bezeichnung: ACO2

Hintergrund: Aconitase 2, mitochondrial (also called Aconitate hydratase, mitochondrial) is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15 (PRSS15), also known as Lon protease, after oxidative modification.

UniProt: Q99798