STX1A Antikörper (Intracellular, N-Term)

Produktnummer ABIN7237876

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch STX1A in WB, IHC und IF. Es zeigt Reaktivität gegenüber Proben von Ratte.

Kurzübersicht für STX1A Antikörper (Intracellular, N-Term) (ABIN7237876)

Target: STX1A (Syntaxin 1A (Brain) (STX1A))

Reaktivität: Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STX1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)

Produktdetails anti-STX1A Antikörper

Bindungsspezifität: AA 1-265, Intracellular, N-Term

Verwendungszweck: A Rabbit Polyclonal Antibody to Syntaxin 1

Kreuzreaktivität: Maus, Ratte

Homologie: Human,mouse- 264,265 amino acid residues identical

Produktmerkmale: Intracellular, N-terminus

Aufreinigung: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen: GST fusion protein with the sequence MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK, corresponding to amino acid residues 1-265 of rat syntaxin 1A

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

WB: 1:1000

FC: The optimal concentration should be determined by the user

ICC: The optimal concentration should be determined by the user

IHC: The optimal concentration should be determined by the user

IP: The optimal concentration should be determined by the user

Kommentare:

Cited Application: IP

Negative Control: (ABIN7237335)

Blocking Peptide: (ABIN7237335)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Konzentration: 0.8 mg/mL

Buffer: PBS pH 7.4, 1 % BSA with 0.05 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Details zu STX1A

Target: STX1A (Syntaxin 1A (Brain) (STX1A))

Andere Bezeichnung: STX1A

Hintergrund:

Synonyms: STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1

Description: Syntaxin 1 is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) protein superfamily. The family includes 36 members in humans and is characterized by the SNARE motif, an evolutionarily conserved stretch of 60-70 amino acids that are arranged in heptad repeats1,2.SNARE proteins are involved in exocytosis and intracellular vesicle trafficking and are essential for cell growth, hormone secretion and neurotransmission, processes that require rapid, targeted, and regulated membrane fusion1,2.SNAREs can be roughly divided into vesicular (v-SNAREs) and target (t-SNAREs) based on their distribution on the transport vesicle or target membrane respectively. Thus, assembly of cognate v-/t-SNAREs between two opposing membranes generates trans-SNARE complexes, which bring the lipid bilayers in close proximity and drive membrane fusion.Syntaxin 1, like most SNAREs, is a type IV membrane protein with a relatively large N-terminus containing the SNARE motif located in the cytoplasmic side and a transmembrane domain located close to the C-terminus that functions as an anchor1,2.Syntaxin 1 has been extensively studied for its role on neuronal and neuroendocrine cell exocytosis where it functions as the plasma membrane protein t-SNARE, which together with the vesicular v-SNARE protein VAMP and the membrane-associated SNAP-25 (synaptosome-associated protein 25 kDa), forms a trimeric, four-helical complex, which drives fusion of the two opposing bilayers1,2.Syntaxin 1 together with SNAP-25 is the target of the neurotoxin botulinum neurotoxin type C (BoNT/C) which following proteolytic degradation of the proteins causes inhibition of neurotransmitter release 3.

Gen-ID: 116470

NCBI Accession: NM_004603

UniProt: P32851

Pathways: Peptide Hormone Metabolism, Synaptic Membrane, Synaptic Vesicle Exocytosis, Dicarboxylic Acid Transport