TMEM166 Antikörper
-
- Target Alle TMEM166 (FAM176A) Antikörper anzeigen
- TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM166 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro)), Flow Cytometry (FACS), Immunocytochemistry (ICC)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for TMEM166/EVA1A detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Sequenz
- MRLPLSHSPE HVEMALLSNI LAAYSFVSEN PERA
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Rabbit IgG polyclonal antibody for TMEM166/EVA1A detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A(MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).
- Isotyp
- IgG
- Top Product
- Discover our top product FAM176A Primärantikörper
-
-
- Applikationshinweise
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells
- Kommentare
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))
- Andere Bezeichnung
- EVA1A (FAM176A Produkte)
- Synonyme
- Fam176a antikoerper, RGD1559797 antikoerper, Tmem166 antikoerper, FAM176A antikoerper, TMEM166 antikoerper, BC014699 antikoerper, eva-1 homolog A, regulator of programmed cell death antikoerper, eva-1 homolog A (C. elegans) antikoerper, Eva1a antikoerper, EVA1A antikoerper
- Hintergrund
-
Synonyms: Protein eva-1 homolog A, Protein FAM176A, Transmembrane protein 166, EVA1A, FAM176A, TMEM166, SP24
Background: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
- Gen-ID
- 84141
- UniProt
- Q9H8M9
-