TMEM166 Antikörper

Produktnummer ABIN6719564

Produktdetails anti-TMEM166 Antikörper

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM166 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro)), Flow Cytometry (FACS), Immunocytochemistry (ICC)

Verwendungszweck: Rabbit IgG polyclonal antibody for TMEM166/EVA1A detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Sequenz: MRLPLSHSPE HVEMALLSNI LAAYSFVSEN PERA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for TMEM166/EVA1A detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A(MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Kommentare:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu TMEM166

Target: TMEM166 (FAM176A) (Family with Sequence Similarity 176, Member A (FAM176A))

Andere Bezeichnung: EVA1A (FAM176A Produkte)

Synonyme: Fam176a antikoerper, RGD1559797 antikoerper, Tmem166 antikoerper, FAM176A antikoerper, TMEM166 antikoerper, BC014699 antikoerper, eva-1 homolog A, regulator of programmed cell death antikoerper, eva-1 homolog A (C. elegans) antikoerper, Eva1a antikoerper, EVA1A antikoerper

Hintergrund:

Synonyms: Protein eva-1 homolog A, Protein FAM176A, Transmembrane protein 166, EVA1A, FAM176A, TMEM166, SP24

Background: Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Gen-ID: 84141

UniProt: Q9H8M9