AMH Antikörper

Produktnummer ABIN643496

Der Maus Monoklonal anti-AMH Antikörper wird verwendet zum Nachweis von AMH in Proben von Human. Er wurde validiert für IHC (p).

Kurzübersicht für AMH Antikörper (ABIN643496)

Target: AMH (Anti-Mullerian Hormone (AMH))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser AMH Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-AMH Antikörper

Verwendungszweck: Mouse Anti-Human AMH

Spezifität: DS-MB-02769 is specific for human anti-mullerian hormone (AMH), originally classified as a fetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. DS-MB-02769 is reported to crossreact with mouse.

Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)

Isotyp: IgG1

Anwendungsinformationen

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: -20°C

Details zu AMH

Target: AMH (Anti-Mullerian Hormone (AMH))

Andere Bezeichnung: AMH

Pathways: Negative Regulation of Hormone Secretion