CYB561 Antikörper (Middle Region)

Produktnummer ABIN636106

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CYB561 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für CYB561 Antikörper (Middle Region) (ABIN636106)

Target: CYB561 (Cytochrome B-561 (CYB561))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYB561 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CYB561 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CYB561 antibody was raised against the middle region of CYB561

Aufreinigung: Affinity purified

Immunogen: CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYB561 Blocking Peptide, (ABIN940329), is also available for use as a blocking control in assays to test for specificity of this CYB561 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB561 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYB561

Target: CYB561 (Cytochrome B-561 (CYB561))

Andere Bezeichnung: CYB561

Hintergrund: CYB561 is a senescene-associated protein in normal human oral keratinocytes.

Molekulargewicht: 27 kDa (MW of target protein)