SLC22A6 Antikörper

Produktnummer ABIN636098

Produktdetails anti-SLC22A6 Antikörper

Target: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC22 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A6 Blocking Peptide, catalog no. 33R-2764, is also available for use as a blocking control in assays to test for specificity of this SLC22A6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A6

Target: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Andere Bezeichnung: SLC22A6 (SLC22A6 Produkte)

Synonyme: HOAT1 antikoerper, OAT1 antikoerper, PAHT antikoerper, ROAT1 antikoerper, NKT antikoerper, Oat1 antikoerper, Orctl1 antikoerper, mOat1 antikoerper, slc22a6 antikoerper, zgc:77073 antikoerper, SLC22A6 antikoerper, Paht antikoerper, Roat1 antikoerper, nkt antikoerper, oat1 antikoerper, oat1-B antikoerper, paht antikoerper, roat1 antikoerper, slc22a6-B antikoerper, Slc22a6 antikoerper, solute carrier family 22 member 6 antikoerper, solute carrier family 22 (organic anion transporter), member 6 antikoerper, solute carrier family 22 (organic anion transporter), member 6, like antikoerper, Solute carrier family 22 member 6 antikoerper, solute carrier family 22 (organic anion transporter), member 6 S homeolog antikoerper, SLC22A6 antikoerper, Slc22a6 antikoerper, slc22a6l antikoerper, s22a6 antikoerper, slc22a6.S antikoerper

Hintergrund: SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport