SLC22A6 Antikörper

Produktnummer ABIN636098

Der Kaninchen Polyklonal Anti-SLC22A6 Antikörper wurde für WB validiert. Er ist geeignet, SLC22A6 in Proben von Human, Ratte und Maus zu detektieren.

Kurzübersicht für SLC22A6 Antikörper (ABIN636098)

Target: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC22A6 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC22 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A6 Blocking Peptide, (ABIN938150), is also available for use as a blocking control in assays to test for specificity of this SLC22A6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A6

Target: SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))

Andere Bezeichnung: SLC22A6

Hintergrund: SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport