SLC22A6 Antikörper
-
- Target Alle SLC22A6 Antikörper anzeigen
- SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC22 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP
- Top Product
- Discover our top product SLC22A6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A6 Blocking Peptide, catalog no. 33R-1168, is also available for use as a blocking control in assays to test for specificity of this SLC22A6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A6 (Solute Carrier Family 22 Member 6 (SLC22A6))
- Andere Bezeichnung
- SLC22A6 (SLC22A6 Produkte)
- Synonyme
- HOAT1 antikoerper, OAT1 antikoerper, PAHT antikoerper, ROAT1 antikoerper, NKT antikoerper, Oat1 antikoerper, Orctl1 antikoerper, mOat1 antikoerper, slc22a6 antikoerper, zgc:77073 antikoerper, SLC22A6 antikoerper, Paht antikoerper, Roat1 antikoerper, nkt antikoerper, oat1 antikoerper, oat1-B antikoerper, paht antikoerper, roat1 antikoerper, slc22a6-B antikoerper, Slc22a6 antikoerper, solute carrier family 22 member 6 antikoerper, solute carrier family 22 (organic anion transporter), member 6 antikoerper, solute carrier family 22 (organic anion transporter), member 6, like antikoerper, Solute carrier family 22 member 6 antikoerper, solute carrier family 22 (organic anion transporter), member 6 S homeolog antikoerper, SLC22A6 antikoerper, Slc22a6 antikoerper, slc22a6l antikoerper, s22a6 antikoerper, slc22a6.S antikoerper
- Hintergrund
- SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-