Coagulation Factor X Antikörper (C-Term)

Produktnummer ABIN636058

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Coagulation Factor X in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Coagulation Factor X Antikörper (C-Term) (ABIN636058)

Target: Coagulation Factor X (F10)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Coagulation Factor X Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Coagulation Factor X Antikörper

Bindungsspezifität: C-Term

Spezifität: Factor X antibody was raised against the C terminal of F10

Aufreinigung: Affinity purified

Immunogen: Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Factor X Blocking Peptide, (ABIN5613449), is also available for use as a blocking control in assays to test for specificity of this Factor X antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Coagulation Factor X

Target: Coagulation Factor X (F10)

Andere Bezeichnung: Factor X

Hintergrund: F10 is the vitamin K-dependent coagulation factor X of the blood coagulation cascade. This factor undergoes multiple processing steps before its preproprotein is converted to a mature two-chain form by the excision of the tripeptide RKR. Two chains of the factor are held together by 1 or more disulfide bonds, the light chain contains 2 EGF-like domains, while the heavy chain contains the catalytic domain which is structurally homologous to those of the other hemostatic serine proteases. The mature factor is activated by the cleavage of the activation peptide by factor IXa (in the intrisic pathway), or by factor VIIa (in the extrinsic pathway). The activated factor then converts prothrombin to thrombin in the presence of factor Va, Ca+2, and phospholipid during blood clotting.

Molekulargewicht: 29 kDa (MW of target protein)