FZD5 Antikörper

Produktnummer ABIN636048

Dieser Anti-FZD5 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von FZD5 in WB. Geeignet für Human.

Kurzübersicht für FZD5 Antikörper (ABIN636048)

Target: FZD5 (Frizzled Family Receptor 5 (FZD5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FZD5 Antikörper

Aufreinigung: Affinity purified

Immunogen: FZD5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD5 Blocking Peptide, (ABIN937222), is also available for use as a blocking control in assays to test for specificity of this FZD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD5

Target: FZD5 (Frizzled Family Receptor 5 (FZD5))

Andere Bezeichnung: FZD5

Hintergrund: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: WNT Signalweg