FZD4 Antikörper

Produktnummer ABIN636047

Produktdetails anti-FZD4 Antikörper

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD4 Blocking Peptide, catalog no. 33R-3346, is also available for use as a blocking control in assays to test for specificity of this FZD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD4

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Andere Bezeichnung: FZD4 (FZD4 Produkte)

Synonyme: CG4626 antikoerper, DFz4 antikoerper, Dfz4 antikoerper, Dm Fz4 antikoerper, Dmel\\CG4626 antikoerper, Fz4 antikoerper, anon-WO0170980.10 antikoerper, anon-WO0170980.11 antikoerper, fz1 antikoerper, zg01 antikoerper, CD344 antikoerper, EVR1 antikoerper, FEVR antikoerper, FZD4S antikoerper, Fz-4 antikoerper, FzE4 antikoerper, GPCR antikoerper, hFz4 antikoerper, frizzled4 antikoerper, fz4 antikoerper, FZ-4 antikoerper, frizzled 4 antikoerper, frizzled class receptor 4 antikoerper, frizzled-4 antikoerper, frizzled class receptor 4 S homeolog antikoerper, fz4 antikoerper, fzd4 antikoerper, Tsp_10376 antikoerper, FZD4 antikoerper, Fzd4 antikoerper, fzd4.S antikoerper

Hintergrund: FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: WNT Signalweg, Hormone Transport, Sensory Perception of Sound