FZD4 Antikörper

Produktnummer ABIN636047

Der Kaninchen Polyklonal Anti-FZD4-Antikörper wurde für WB und IHC validiert. Er ist geeignet, FZD4 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für FZD4 Antikörper (ABIN636047)

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-FZD4 Antikörper

Aufreinigung: Affinity purified

Immunogen: FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD4 Blocking Peptide, (ABIN938732), is also available for use as a blocking control in assays to test for specificity of this FZD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD4

Target: FZD4 (Frizzled Family Receptor 4 (FZD4))

Andere Bezeichnung: FZD4

Hintergrund: FZD4 is a member of the frizzled family. Members of this family are seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: WNT Signalweg, Hormone Transport, Sensory Perception of Sound