GPR56 Antikörper (N-Term)

Produktnummer ABIN636036

Dieses Anti-GPR56-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GPR56 in WB. Geeignet für Human.

Kurzübersicht für GPR56 Antikörper (N-Term) (ABIN636036)

Target: GPR56 (G Protein-Coupled Receptor 56 (GPR56))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPR56 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GPR56 Antikörper

Bindungsspezifität: N-Term

Spezifität: GPR56 antibody was raised against the N terminal of GPR56

Aufreinigung: Affinity purified

Immunogen: GPR56 antibody was raised using the N terminal of GPR56 corresponding to a region with amino acids MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPR56 Blocking Peptide, (ABIN5613836), is also available for use as a blocking control in assays to test for specificity of this GPR56 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR56 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPR56

Target: GPR56 (G Protein-Coupled Receptor 56 (GPR56))

Andere Bezeichnung: GPR56

Hintergrund: GPR56 could be involved in cell-cell interactions.

Molekulargewicht: 76 kDa (MW of target protein)