TXNDC15 Antikörper (C-Term)

Produktnummer ABIN636013

Produktdetails anti-TXNDC15 Antikörper

Target: TXNDC15 (Thioredoxin Domain Containing 15 (TXNDC15))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TXNDC15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TXNDC15 antibody was raised against the C terminal of TXNDC15

Aufreinigung: Affinity purified

Immunogen: TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TXNDC15 Blocking Peptide, catalog no. 33R-8886, is also available for use as a blocking control in assays to test for specificity of this TXNDC15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TXNDC15

Target: TXNDC15 (Thioredoxin Domain Containing 15 (TXNDC15))

Andere Bezeichnung: TXNDC15 (TXNDC15 Produkte)

Synonyme: C5orf14 antikoerper, UNQ335 antikoerper, 2310047H23Rik antikoerper, AI854086 antikoerper, RGD1304696 antikoerper, thioredoxin domain containing 15 L homeolog antikoerper, thioredoxin domain containing 15 antikoerper, txndc15.L antikoerper, TXNDC15 antikoerper, Txndc15 antikoerper

Hintergrund: TXNDC15 is a single-pass type I membrane protein. It contains 1 thioredoxin domain.

Molekulargewicht: 40 kDa (MW of target protein)