MANEA Antikörper (Middle Region)

Produktnummer ABIN636012

Dieses Anti-MANEA-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MANEA in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für MANEA Antikörper (Middle Region) (ABIN636012)

Target: MANEA (Mannosidase, Endo-alpha (MANEA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MANEA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MANEA Antikörper

Bindungsspezifität: Middle Region

Spezifität: MANEA antibody was raised against the middle region of MANEA

Aufreinigung: Affinity purified

Immunogen: MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MANEA Blocking Peptide, (ABIN940109), is also available for use as a blocking control in assays to test for specificity of this MANEA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MANEA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MANEA

Target: MANEA (Mannosidase, Endo-alpha (MANEA))

Andere Bezeichnung: MANEA

Hintergrund: N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex.

Molekulargewicht: 54 kDa (MW of target protein)