UGT2B4 Antikörper (N-Term)

Produktnummer ABIN636004

Produktdetails anti-UGT2B4 Antikörper

Target: UGT2B4 (UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT2B4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT2 B4 antibody was raised against the N terminal of µgT2 4

Aufreinigung: Affinity purified

Immunogen: UGT2 B4 antibody was raised using the N terminal of µgT2 4 corresponding to a region with amino acids NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT2B4 Blocking Peptide, catalog no. 33R-6722, is also available for use as a blocking control in assays to test for specificity of this µgT2B4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT2B4

Target: UGT2B4 (UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4))

Andere Bezeichnung: UGT2B4 (UGT2B4 Produkte)

Synonyme: HLUG25 antikoerper, UDPGTH1 antikoerper, UGT2B11 antikoerper, UDPGT2B4 antikoerper, UGT2B17 antikoerper, UGT2B28 antikoerper, UDP glucuronosyltransferase family 2 member B4 antikoerper, UDP-glucuronosyltransferase 2B4 antikoerper, UGT2B4 antikoerper, LOC615303 antikoerper, LOC100066359 antikoerper

Hintergrund: UGT2B4 belongs to the UDP-glycosyltransferase family. UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis