FAM20A Antikörper (N-Term)

Produktnummer ABIN635991

Produktdetails anti-FAM20A Antikörper

Target: FAM20A (Family with Sequence Similarity 20, Member A (FAM20A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM20A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM20 A antibody was raised against the N terminal of FAM20

Aufreinigung: Affinity purified

Immunogen: FAM20 A antibody was raised using the N terminal of FAM20 corresponding to a region with amino acids SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM20A Blocking Peptide, catalog no. 33R-8558, is also available for use as a blocking control in assays to test for specificity of this FAM20A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM20A

Target: FAM20A (Family with Sequence Similarity 20, Member A (FAM20A))

Andere Bezeichnung: FAM20A (FAM20A Produkte)

Synonyme: AIGFS antikoerper, FP2747 antikoerper, AI606893 antikoerper, FAM20A, golgi associated secretory pathway pseudokinase antikoerper, family with sequence similarity 20, member A antikoerper, FAM20A antikoerper, Fam20a antikoerper

Hintergrund: The exact function of this gene remains unknown.

Molekulargewicht: 61 kDa (MW of target protein)