GOLM1 Antikörper (N-Term)

Produktnummer ABIN635986

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GOLM1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für GOLM1 Antikörper (N-Term) (ABIN635986)

Target: GOLM1 (Golgi Membrane Protein 1 (GOLM1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GOLM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GOLM1 Antikörper

Bindungsspezifität: N-Term

Spezifität: GOLM1 antibody was raised against the N terminal of GOLM1

Aufreinigung: Affinity purified

Immunogen: GOLM1 antibody was raised using the N terminal of GOLM1 corresponding to a region with amino acids RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GOLM1 Blocking Peptide, (ABIN5613820), is also available for use as a blocking control in assays to test for specificity of this GOLM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GOLM1

Target: GOLM1 (Golgi Membrane Protein 1 (GOLM1))

Andere Bezeichnung: GOLM1

Hintergrund: GOLM1 is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Molekulargewicht: 45 kDa (MW of target protein)