ALG1 Antikörper (N-Term)

Produktnummer ABIN635919

Der Kaninchen Polyklonal anti-ALG1 Antikörper (ABIN635919) detektiert spezifisch ALG1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ALG1 Antikörper (N-Term) (ABIN635919)

Target: ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALG1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ALG1 antibody was raised against the N terminal of ALG1

Aufreinigung: Affinity purified

Immunogen: ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALG1 Blocking Peptide, (ABIN5612017), is also available for use as a blocking control in assays to test for specificity of this ALG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALG1

Target: ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))

Andere Bezeichnung: ALG1

Hintergrund: ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).

Molekulargewicht: 52 kDa (MW of target protein)