ACP2 Antikörper (Middle Region)

Produktnummer ABIN635914

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ACP2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für ACP2 Antikörper (Middle Region) (ABIN635914)

Target: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACP2 antibody was raised against the middle region of ACP2

Aufreinigung: Affinity purified

Immunogen: ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACP2 Blocking Peptide, (ABIN5611912), is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACP2

Target: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Andere Bezeichnung: ACP2

Hintergrund: ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.

Molekulargewicht: 45 kDa (MW of target protein)