ACP2 Antikörper (Middle Region)

Produktnummer ABIN635914

Produktdetails anti-ACP2 Antikörper

Target: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACP2 antibody was raised against the middle region of ACP2

Aufreinigung: Affinity purified

Immunogen: ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACP2 Blocking Peptide, catalog no. 33R-9731, is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACP2

Target: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Andere Bezeichnung: ACP2 (ACP2 Produkte)

Synonyme: ACP2 antikoerper, Acp-2 antikoerper, LAP antikoerper, acid phosphatase 2, lysosomal antikoerper, acid phosphatase 2, lysosomal S homeolog antikoerper, ACP2 antikoerper, acp2 antikoerper, Acp2 antikoerper, acp2.S antikoerper

Hintergrund: ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.

Molekulargewicht: 45 kDa (MW of target protein)