PTGS1 Antikörper (Middle Region)

Produktnummer ABIN635890

Produktdetails anti-PTGS1 Antikörper

Target: PTGS1 (Prostaglandin-Endoperoxide Synthase 1 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTGS1 antibody was raised against the middle region of PTGS1

Aufreinigung: Affinity purified

Immunogen: PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTGS1 Blocking Peptide, catalog no. 33R-3265, is also available for use as a blocking control in assays to test for specificity of this PTGS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTGS1

Target: PTGS1 (Prostaglandin-Endoperoxide Synthase 1 (Prostaglandin G/H Synthase and Cyclooxygenase) (PTGS1))

Andere Bezeichnung: PTGS1 (PTGS1 Produkte)

Hintergrund: Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis.

Molekulargewicht: 66 kDa (MW of target protein)