LMAN2 Antikörper (C-Term)

Produktnummer ABIN635888

Der Kaninchen Polyklonal Anti-LMAN2-Antikörper wurde für WB validiert. Er ist geeignet, LMAN2 in Proben von Human und Hund zu detektieren.

Kurzübersicht für LMAN2 Antikörper (C-Term) (ABIN635888)

Target: LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LMAN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LMAN2 Antikörper

Bindungsspezifität: C-Term

Spezifität: LMAN2 antibody was raised against the C terminal of LMAN2

Aufreinigung: Affinity purified

Immunogen: LMAN2 antibody was raised using the C terminal of LMAN2 corresponding to a region with amino acids LMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LMAN2 Blocking Peptide, (ABIN5614475), is also available for use as a blocking control in assays to test for specificity of this LMAN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LMAN2

Target: LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))

Andere Bezeichnung: LMAN2

Hintergrund: LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom