LMAN2 Antikörper (N-Term)

Produktnummer ABIN635887

Produktdetails anti-LMAN2 Antikörper

Target: LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LMAN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: LMAN2 antibody was raised against the N terminal of LMAN2

Aufreinigung: Affinity purified

Immunogen: LMAN2 antibody was raised using the N terminal of LMAN2 corresponding to a region with amino acids SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LMAN2 Blocking Peptide, catalog no. 33R-8595, is also available for use as a blocking control in assays to test for specificity of this LMAN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LMAN2

Target: LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))

Andere Bezeichnung: LMAN2 (LMAN2 Produkte)

Synonyme: Lman2 antikoerper, wu:fb16f04 antikoerper, zgc:158761 antikoerper, C5orf8 antikoerper, GP36B antikoerper, VIP36 antikoerper, 1110003H06Rik antikoerper, 1300009F09Rik antikoerper, AA408240 antikoerper, AL023023 antikoerper, AU040819 antikoerper, Vip36 antikoerper, lectin, mannose binding 2 antikoerper, lectin, mannose-binding 2 antikoerper, LMAN2 antikoerper, lman2 antikoerper, Lman2 antikoerper

Hintergrund: LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom