PERP Antikörper (Middle Region)
-
- Target Alle PERP Antikörper anzeigen
- PERP (TP53 Apoptosis Effector (PERP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PERP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PERP antibody was raised against the middle region of PERP
- Aufreinigung
- Affinity purified
- Immunogen
- PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG
- Top Product
- Discover our top product PERP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PERP Blocking Peptide, catalog no. 33R-2984, is also available for use as a blocking control in assays to test for specificity of this PERP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PERP (TP53 Apoptosis Effector (PERP))
- Andere Bezeichnung
- PERP (PERP Produkte)
- Hintergrund
- PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Positive Regulation of Endopeptidase Activity
-