TEX264 Antikörper (Middle Region)

Produktnummer ABIN635856

Dieses Anti-TEX264-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TEX264 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für TEX264 Antikörper (Middle Region) (ABIN635856)

Target: TEX264 (Testis Expressed 264 (TEX264))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TEX264 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TEX264 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TEX264 antibody was raised against the middle region of TEX264

Aufreinigung: Affinity purified

Immunogen: TEX264 antibody was raised using the middle region of TEX264 corresponding to a region with amino acids GWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TEX264 Blocking Peptide, (ABIN939052), is also available for use as a blocking control in assays to test for specificity of this TEX264 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX264 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TEX264

Target: TEX264 (Testis Expressed 264 (TEX264))

Andere Bezeichnung: TEX264

Hintergrund: The specific function of TEX264 is not yet known.

Molekulargewicht: 34 kDa (MW of target protein)