IL11RA Antikörper (N-Term)
-
- Target Alle IL11RA Antikörper anzeigen
- IL11RA (Interleukin 11 Receptor, alpha (IL11RA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL11RA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL11 R alpha antibody was raised against the N terminal of IL11 A
- Aufreinigung
- Affinity purified
- Immunogen
- IL11 R alpha antibody was raised using the N terminal of IL11 A corresponding to a region with amino acids QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGAD
- Top Product
- Discover our top product IL11RA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL11R alpha Blocking Peptide, catalog no. 33R-7626, is also available for use as a blocking control in assays to test for specificity of this IL11R alpha antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL11RA (Interleukin 11 Receptor, alpha (IL11RA))
- Andere Bezeichnung
- IL11R alpha (IL11RA Produkte)
- Synonyme
- CRSDA antikoerper, fi26e06 antikoerper, il-11ra antikoerper, wu:fi26e06 antikoerper, AI314697 antikoerper, GP130 antikoerper, Il-11ra antikoerper, Il11ra antikoerper, Il11ra2 antikoerper, NR1 antikoerper, interleukin 11 receptor subunit alpha antikoerper, interleukin 11 receptor, alpha antikoerper, interleukin 11 receptor subunit alpha 1 antikoerper, interleukin 11 receptor, alpha chain 1 antikoerper, IL11RA antikoerper, il11ra antikoerper, Il11ra1 antikoerper, Il11ra antikoerper
- Hintergrund
- Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.
- Molekulargewicht
- 43 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Growth Factor Binding
-