IL11RA Antikörper (Middle Region)

Produktnummer ABIN635795

Produktdetails anti-IL11RA Antikörper

Target: IL11RA (Interleukin 11 Receptor, alpha (IL11RA))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL11RA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IL11 R alpha antibody was raised against the middle region of IL11 A

Aufreinigung: Affinity purified

Immunogen: IL11 R alpha antibody was raised using the middle region of IL11 A corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL11R alpha Blocking Peptide, catalog no. 33R-2968, is also available for use as a blocking control in assays to test for specificity of this IL11R alpha antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL11RA

Target: IL11RA (Interleukin 11 Receptor, alpha (IL11RA))

Andere Bezeichnung: IL11R alpha (IL11RA Produkte)

Synonyme: CRSDA antikoerper, fi26e06 antikoerper, il-11ra antikoerper, wu:fi26e06 antikoerper, AI314697 antikoerper, GP130 antikoerper, Il-11ra antikoerper, Il11ra antikoerper, Il11ra2 antikoerper, NR1 antikoerper, interleukin 11 receptor subunit alpha antikoerper, interleukin 11 receptor, alpha antikoerper, interleukin 11 receptor subunit alpha 1 antikoerper, interleukin 11 receptor, alpha chain 1 antikoerper, IL11RA antikoerper, il11ra antikoerper, Il11ra1 antikoerper, Il11ra antikoerper

Hintergrund: Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Growth Factor Binding