IGSF9 Antikörper (N-Term)

Produktnummer ABIN635786

Der Kaninchen Polyklonal Anti-IGSF9-Antikörper wurde für WB validiert. Er ist geeignet, IGSF9 in Proben von Human zu detektieren.

Kurzübersicht für IGSF9 Antikörper (N-Term) (ABIN635786)

Target: IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGSF9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IGSF9 Antikörper

Bindungsspezifität: N-Term

Spezifität: IGSF9 antibody was raised against the N terminal of IGSF9

Aufreinigung: Affinity purified

Immunogen: IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IGSF9 Blocking Peptide, (ABIN5614164), is also available for use as a blocking control in assays to test for specificity of this IGSF9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGSF9

Target: IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))

Andere Bezeichnung: IGSF9

Hintergrund: IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.

Molekulargewicht: 125 kDa (MW of target protein)