LCAT Antikörper (C-Term)

Produktnummer ABIN635780

Produktdetails anti-LCAT Antikörper

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LCAT antibody was raised against the C terminal of LCAT

Aufreinigung: Affinity purified

Immunogen: LCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LCAT Blocking Peptide, catalog no. 33R-3643, is also available for use as a blocking control in assays to test for specificity of this LCAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCAT

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Andere Bezeichnung: LCAT (LCAT Produkte)

Synonyme: AI046659 antikoerper, D8Wsu61e antikoerper, MGC82035 antikoerper, lcat antikoerper, MGC88964 antikoerper, LCAT antikoerper, lecithin-cholesterol acyltransferase antikoerper, lecithin cholesterol acyltransferase antikoerper, lecithin-cholesterol acyltransferase L homeolog antikoerper, solute carrier family 12 member 4 antikoerper, fragile site, aphidicolin type, common, fra(13)(q13.2) antikoerper, LCAT antikoerper, Lcat antikoerper, lcat.L antikoerper, lcat antikoerper, SLC12A4 antikoerper, FRA13A antikoerper

Hintergrund: LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Lipid Metabolism