GNS Antikörper (C-Term)

Produktnummer ABIN635775

Produktdetails anti-GNS Antikörper

Target: GNS (Glucosamine (N-Acetyl)-6-Sulfatase (GNS))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GNS antibody was raised against the C terminal of GNS

Aufreinigung: Affinity purified

Immunogen: GNS antibody was raised using the C terminal of GNS corresponding to a region with amino acids PILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNS Blocking Peptide, catalog no. 33R-7159, is also available for use as a blocking control in assays to test for specificity of this GNS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNS

Target: GNS (Glucosamine (N-Acetyl)-6-Sulfatase (GNS))

Andere Bezeichnung: GNS (GNS Produkte)

Synonyme: G6S antikoerper, 2610016K11Rik antikoerper, AU042285 antikoerper, C87209 antikoerper, N28088 antikoerper, NV14559 antikoerper, N-acetylglucosamine-6-sulfatase antikoerper, zgc:114066 antikoerper, gns antikoerper, wu:fi20h10 antikoerper, zgc:55370 antikoerper, glucosamine (N-acetyl)-6-sulfatase antikoerper, glucosamine (N-acetyl)-6-sulfatase S homeolog antikoerper, glucosamine (N-acetyl)-6-sulfatase a antikoerper, N-acetylglucosamine-6-sulfatase antikoerper, glucosamine (N-acetyl)-6-sulfatase (Sanfilippo disease IIID), b antikoerper, GNS antikoerper, Gns antikoerper, gns.S antikoerper, gns antikoerper, gnsa antikoerper, CpipJ_CPIJ000745 antikoerper, Sros_7372 antikoerper, VDBG_04409 antikoerper, Halhy_3165 antikoerper, gnsb antikoerper

Hintergrund: GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process