ZP4 Antikörper (N-Term)

Produktnummer ABIN635764

Produktdetails anti-ZP4 Antikörper

Target: ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZP4 antibody was raised against the N terminal of ZP4

Aufreinigung: Affinity purified

Immunogen: ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZP4 Blocking Peptide, catalog no. 33R-6616, is also available for use as a blocking control in assays to test for specificity of this ZP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZP4

Target: ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))

Andere Bezeichnung: ZP4 (ZP4 Produkte)

Synonyme: ZPB antikoerper, xlZPB antikoerper, lzpb-a antikoerper, MGC154827 antikoerper, zbp antikoerper, zp1 antikoerper, ZBP antikoerper, TAC4 antikoerper, MGC154888 antikoerper, ZP1 antikoerper, Zp-4 antikoerper, ZP3-ALPHA antikoerper, ZP antikoerper, Zp-X antikoerper, zona pellucida glycoprotein 4 S homeolog antikoerper, zona pellucida glycoprotein 4 antikoerper, zona pellucida glycoprotein 4 L homeolog antikoerper, zp4.S antikoerper, zp4 antikoerper, ZP4 antikoerper, zp4.L antikoerper, Zp4 antikoerper

Hintergrund: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix.

Molekulargewicht: 49 kDa (MW of target protein)