ZP4 Antikörper (N-Term)

Produktnummer ABIN635764

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ZP4 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ZP4 Antikörper (N-Term) (ABIN635764)

Target: ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZP4 Antikörper

Bindungsspezifität: N-Term

Spezifität: ZP4 antibody was raised against the N terminal of ZP4

Aufreinigung: Affinity purified

Immunogen: ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZP4 Blocking Peptide, (ABIN5617269), is also available for use as a blocking control in assays to test for specificity of this ZP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZP4

Target: ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))

Andere Bezeichnung: ZP4

Hintergrund: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix.

Molekulargewicht: 49 kDa (MW of target protein)