PAM Antikörper (N-Term)

Produktnummer ABIN635741

Produktdetails anti-PAM Antikörper

Target: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PAM antibody was raised against the N terminal of PAM

Aufreinigung: Affinity purified

Immunogen: PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAM Blocking Peptide, catalog no. 33R-7169, is also available for use as a blocking control in assays to test for specificity of this PAM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAM

Target: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Andere Bezeichnung: PAM (PAM Produkte)

Synonyme: PAL antikoerper, PHM antikoerper, pal antikoerper, phm antikoerper, pamb antikoerper, CG3832 antikoerper, Dmel\\CG3832 antikoerper, dPHM antikoerper, AE-I antikoerper, PAL-A antikoerper, PHM-A antikoerper, pama antikoerper, si:dkeyp-35f12.2 antikoerper, peptidylglycine alpha-amidating monooxygenase antikoerper, peptidylglycine alpha-amidating monooxygenase S homeolog antikoerper, Peptidylglycine-alpha-hydroxylating monooxygenase antikoerper, peptidylglycine alpha-amidating monooxygenase L homeolog antikoerper, PAM antikoerper, Pam antikoerper, pam.S antikoerper, CHLREDRAFT_150435 antikoerper, sce7070 antikoerper, pam antikoerper, Phm antikoerper, pam.L antikoerper

Hintergrund: PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.

Molekulargewicht: 108 kDa (MW of target protein)