ACSL4 Antikörper (N-Term)

Produktnummer ABIN635728

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ACSL4 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ACSL4 Antikörper (N-Term) (ABIN635728)

Target: ACSL4 (Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACSL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACSL4 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACSL4 antibody was raised against the N terminal of ACSL4

Aufreinigung: Affinity purified

Immunogen: ACSL4 antibody was raised using the N terminal of ACSL4 corresponding to a region with amino acids AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACSL4 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ACSL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACSL4

Target: ACSL4 (Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4))

Andere Bezeichnung: ACSL4

Hintergrund: ACSL4 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.

Molekulargewicht: 74 kDa (MW of target protein)