FGG Antikörper (Middle Region)
-
- Target Alle FGG Antikörper anzeigen
- FGG (Fibrinogen gamma Chain (FGG))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FGG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FGG antibody was raised against the middle region of FGG
- Aufreinigung
- Affinity purified
- Immunogen
- FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ
- Top Product
- Discover our top product FGG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FGG Blocking Peptide, catalog no. 33R-3672, is also available for use as a blocking control in assays to test for specificity of this FGG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FGG (Fibrinogen gamma Chain (FGG))
- Andere Bezeichnung
- FGG (FGG Produkte)
- Hintergrund
- FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.
- Molekulargewicht
- 46 kDa (MW of target protein)
-