RPN1 Antikörper (N-Term)

Produktnummer ABIN635683

Produktdetails anti-RPN1 Antikörper

Target: RPN1 (Ribophorin 1 (RPN1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ribophorin I antibody was raised against the N terminal of RPN1

Aufreinigung: Affinity purified

Immunogen: Ribophorin I antibody was raised using the N terminal of RPN1 corresponding to a region with amino acids TSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ribophorin I Blocking Peptide, catalog no. 33R-9295, is also available for use as a blocking control in assays to test for specificity of this Ribophorin I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPN1

Target: RPN1 (Ribophorin 1 (RPN1))

Andere Bezeichnung: Ribophorin I (RPN1 Produkte)

Hintergrund: RPN1 is a type I integral membrane protein found only in the rough endoplasmic reticulum. It is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. RPN1 forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome.

Molekulargewicht: 66 kDa (MW of target protein)