ZDHHC14 Antikörper (N-Term)

Produktnummer ABIN635620

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ZDHHC14 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ZDHHC14 Antikörper (N-Term) (ABIN635620)

Target: ZDHHC14 (Zinc Finger, DHHC-Type Containing 14 (ZDHHC14))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZDHHC14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZDHHC14 Antikörper

Bindungsspezifität: N-Term

Spezifität: ZDHHC14 antibody was raised against the N terminal of ZDHHC14

Aufreinigung: Affinity purified

Immunogen: ZDHHC14 antibody was raised using the N terminal of ZDHHC14 corresponding to a region with amino acids TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZDHHC14 Blocking Peptide, catalog no. 33R-9176, is also available for use as a blocking control in assays to test for specificity of this ZDHHC14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZDHHC14

Target: ZDHHC14 (Zinc Finger, DHHC-Type Containing 14 (ZDHHC14))

Andere Bezeichnung: ZDHHC14

Hintergrund: ZDHHC14 belongs to the DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily. It contains 1 DHHC-type zinc finger. It is a multi-pass membrane protein. The function of ZDHHC14 remains unknown.

Molekulargewicht: 53 kDa (MW of target protein)