MAS1 Antikörper (Middle Region)

Produktnummer ABIN635593

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MAS1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für MAS1 Antikörper (Middle Region) (ABIN635593)

Target: MAS1 (MAS1 Oncogene (MAS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAS1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MAS1 antibody was raised against the middle region of MAS1

Aufreinigung: Affinity purified

Immunogen: MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAS1 Blocking Peptide, (ABIN5614676), is also available for use as a blocking control in assays to test for specificity of this MAS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAS1

Target: MAS1 (MAS1 Oncogene (MAS1))

Andere Bezeichnung: MAS1

Hintergrund: The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Regulation of Carbohydrate Metabolic Process