PCDH15 Antikörper (N-Term)

Produktnummer ABIN635568

Produktdetails anti-PCDH15 Antikörper

Target: PCDH15 (Protocadherin-15 (PCDH15))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDH15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDH15 antibody was raised against the N terminal of PCDH15

Aufreinigung: Affinity purified

Immunogen: PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDH15 Blocking Peptide, catalog no. 33R-3853, is also available for use as a blocking control in assays to test for specificity of this PCDH15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDH15

Target: PCDH15 (Protocadherin-15 (PCDH15))

Andere Bezeichnung: PCDH15 (PCDH15 Produkte)

Synonyme: CDHR15 antikoerper, DFNB23 antikoerper, USH1F antikoerper, BB078305 antikoerper, ENSMUSG00000046980 antikoerper, Gm9815 antikoerper, Ush1f antikoerper, av antikoerper, nmf19 antikoerper, protocadherin-15 antikoerper, protocadherin related 15 antikoerper, protocadherin-15 antikoerper, protocadherin 15 antikoerper, PCDH15 antikoerper, CpipJ_CPIJ005081 antikoerper, Pcdh15 antikoerper

Hintergrund: PCDH15 is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. PCDH15 consists of a signal peptide, 11 extracellular calcium-binding domains, a transmembrane domain and a unique cytoplasmic domain. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene have been associated with hearing loss, which is consistent with its location at the Usher syndrome type 1F (USH1F) critical region on chromosome 10.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Sensory Perception of Sound