ABCC1 Antikörper

Produktnummer ABIN635554

Produktdetails anti-ABCC1 Antikörper

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ABCC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCC1 Blocking Peptide, catalog no. 33R-4941, is also available for use as a blocking control in assays to test for specificity of this ABCC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ABCC1

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Andere Bezeichnung: ABCC1 (ABCC1 Produkte)

Synonyme: ABC29 antikoerper, ABCC antikoerper, GS-X antikoerper, MRP antikoerper, MRP1 antikoerper, Abcc1a antikoerper, Abcc1b antikoerper, Mdrap antikoerper, Mrp1 antikoerper, Avcc1a antikoerper, Mrp antikoerper, ABCC13 antikoerper, ATP binding cassette subfamily C member 1 antikoerper, ATP-binding cassette, sub-family C (CFTR/MRP), member 1 antikoerper, multidrug resistance-associated protein 1 antikoerper, ABCC1 antikoerper, Abcc1 antikoerper, LOC100152428 antikoerper, LOC100346553 antikoerper

Hintergrund: ABCC1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates.

Molekulargewicht: 171 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom