PRSS16 Antikörper
-
- Target Alle PRSS16 Antikörper anzeigen
- PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRSS16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
- Top Product
- Discover our top product PRSS16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRSS16 Blocking Peptide, catalog no. 33R-8518, is also available for use as a blocking control in assays to test for specificity of this PRSS16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))
- Andere Bezeichnung
- PRSS16 (PRSS16 Produkte)
- Synonyme
- TSSP antikoerper, AI448615 antikoerper, protease, serine 16 antikoerper, protease, serine 16 S homeolog antikoerper, protease, serine 16 (thymus) antikoerper, PRSS16 antikoerper, prss16.S antikoerper, prss16 antikoerper, Prss16 antikoerper
- Hintergrund
- This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells.
- Molekulargewicht
- 55 kDa (MW of target protein)
-