PRSS16 Antikörper

Produktnummer ABIN635540

Der Kaninchen Polyklonal anti-PRSS16 Antikörper wird verwendet zum Nachweis von PRSS16 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für PRSS16 Antikörper (ABIN635540)

Target: PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRSS16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRSS16 Antikörper

Aufreinigung: Affinity purified

Immunogen: PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRSS16 Blocking Peptide, (ABIN5615600), is also available for use as a blocking control in assays to test for specificity of this PRSS16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRSS16

Target: PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))

Andere Bezeichnung: PRSS16

Hintergrund: This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells.

Molekulargewicht: 55 kDa (MW of target protein)