ORCTL-2/SLC22A18 Antikörper (Middle Region)
-
- Target Alle ORCTL-2/SLC22A18 (SLC22A18) Antikörper anzeigen
- ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ORCTL-2/SLC22A18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC22 A18 antibody was raised against the middle region of SLC22 18
- Aufreinigung
- Affinity purified
- Immunogen
- SLC22 A18 antibody was raised using the middle region of SLC22 18 corresponding to a region with amino acids IQCPAILAALATLLGAVLSFTCIPASTKGAKTDAQAPLPGGPRASVFDLK
- Top Product
- Discover our top product SLC22A18 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A18 Blocking Peptide, catalog no. 33R-4110, is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))
- Andere Bezeichnung
- SLC22A18 (SLC22A18 Produkte)
- Hintergrund
- This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.
- Molekulargewicht
- 45 kDa (MW of target protein)
-