Seladin 1 Antikörper (Middle Region)

Produktnummer ABIN635527

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Seladin 1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Seladin 1 Antikörper (Middle Region) (ABIN635527)

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Seladin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Seladin 1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DHCR24 antibody was raised against the middle region of DHCR24

Aufreinigung: Affinity purified

Immunogen: DHCR24 antibody was raised using the middle region of DHCR24 corresponding to a region with amino acids AELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHCR24 Blocking Peptide, (ABIN936524), is also available for use as a blocking control in assays to test for specificity of this DHCR24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHCR24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Seladin 1

Target: Seladin 1 (DHCR24) (24-Dehydrocholesterol Reductase (DHCR24))

Andere Bezeichnung: DHCR24

Hintergrund: DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis.

Molekulargewicht: 58 kDa (MW of target protein)